General Information

  • ID:  hor006117
  • Uniprot ID:  P13208
  • Protein name:  Sarafotoxin-E
  • Gene name:  NA
  • Organism:  Atractaspis engaddensis (Israeli burrowing asp) (Israeli mole viper)
  • Family:  Endothelin/sarafotoxin family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Atractaspis (genus), Atractaspidinae (subfamily), Lamprophiidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera , Episquamata , Unidentata , Bifurcata , Squamata (order), Lepidosauria (class), Sauria , Sauropsida , Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0019229 regulation of vasoconstriction; GO:0035821 modulation of process of another organism; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CTCKDMTDKECLYFCHQGIIW
  • Length:  21(270-290)
  • Propeptide:  MALLPRLAAGGLLLLLALAALEGKPAPSALSQLLEKRSEDQAAAGRIIDGGDTKQAARDPSPQRNVEPLCSCKDMSDKECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCSCKDMTDKECLYFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQAARDPSPQRNVEPLCTCNDMTDEECLNFCHQDVIWRDTKQ
  • Signal peptide:  MALLPRLAAGGLLLLLALAALEG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Vasoconstrictor activity. These toxins cause cardiac arrest probably as a result of coronary vasospasm.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-15; 3-11
  • Structure ID:  AF-P13208-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006117_AF2.pdbhor006117_ESM.pdb

Physical Information

Mass: 289493 Formula: C110H165N27O32S5
Absent amino acids: ANPRSV Common amino acids: C
pI: 5.51 Basic residues: 3
Polar residues: 8 Hydrophobic residues: 5
Hydrophobicity: -7.14 Boman Index: -2235
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 6120.95 Extinction Coefficient cystines: 7240
Absorbance 280nm: 362

Literature

  • PubMed ID:  8428983
  • Title:  Cloning and sequence analysis of cDNAs encoding precursors of sarafotoxins. Evidence for an unusual "rosary-type" organization.
  • PubMed ID:  3176048
  • Title:  Sarafotoxins S6: several isotoxins from Atractaspis engaddensis (burrowing asp) venom that affect the heart.
  • PubMed ID:  2845579
  • Title:  Sarafotoxin, a n
  • PubMed ID:  1339278
  • Title:  
  • PubMed ID:  2080919
  • Title:  
  • PubMed ID:  21889567
  • Title:  
  • PubMed ID:  2037041
  • Title:  
  • PubMed ID:  20504727
  • Title:  
  • PubMed ID:  7849060
  • Title: